PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G092300.1.p
Common NameSb07g008580, SORBIDRAFT_07g008580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 321aa    MW: 34756.6 Da    PI: 5.1775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G092300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-161462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W++eEd  l+++++++G+g +W + ++++g++R++k+c++rw++yl
  Sobic.007G092300.1.p 14 KGPWSPEEDAMLKNYIEEHGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                          79*********************************************97 PP

2Myb_DNA-binding39.61.2e-1269111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.007G092300.1.p  69 GDFTPEEDSIICSLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                           789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.796962IPR017930Myb domain
SuperFamilySSF466896.39E-2712109IPR009057Homeodomain-like
SMARTSM007174.0E-131364IPR001005SANT/Myb domain
PfamPF002492.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001673.67E-101662No hitNo description
PROSITE profilePS5129421.49763117IPR017930Myb domain
SMARTSM007171.7E-1167115IPR001005SANT/Myb domain
PfamPF002495.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2370117IPR009057Homeodomain-like
CDDcd001674.22E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDAMLKNYIE EHGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSIIC SLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGR  120
RKDHHRQSAA DASTSTSTGE NMNDGEPAAL SASAMERIQL CMQLQNNHPL PLMWPGCGSR  180
ASTQSNNSFN SNGSSVTMAE QGQSSSSLNE QQHHLVMSAQ LEGAAGAIDN GLASPSSAEN  240
SNMISMEAEL EELLYGADDN PQGNAAAAAA GMVDGGGVQQ VDVDWWSYDQ QAAGKSPVGC  300
WDFTPETNTV FLDYASVYDI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117881e-144AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445306.10.0hypothetical protein SORBIDRAFT_07g008580
SwissprotQ9FKL22e-89MYB36_ARATH; Transcription factor MYB36
TrEMBLC5YJL70.0C5YJL7_SORBI; Putative uncharacterized protein Sb07g008580
STRINGSb07g008580.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-79myb domain protein 36